Home Domain Lookup actividadesdeinfantilyprimaria.com
Safe No MX

actividadesdeinfantilyprimaria.com Email Domain Risk Check

No disposable signals found

RiskMail did not find temporary or disposable email signals for this domain. No MX records were found, so this domain has been queued for review.

Domain Resolves
No
Has MX Records
No
Disposable
No
Free Provider
No
Shared MX
No
Classification
Disposable / Temporary No Listed as a temporary / disposable email provider.
Free Email Provider No Public webmail service (Gmail, Outlook, Yandex…).
Business Domain No Likely an organization-owned email domain.
Shared Mail Infrastructure No Uses a multi-tenant inbound MX (Workspace, M365, Yandex…).
Has MX Records No DNS-resolvable mail-exchanger records.
MX Records & Mail Server
No MX records found. This domain cannot receive email.
Provider
API response for this domain
200 OK
GET /api/v1/domain/actividadesdeinfantilyprimaria.com?key=YOUR_API_KEY
{
  "domain": "actividadesdeinfantilyprimaria.com",
  "email": "",
  "input": "actividadesdeinfantilyprimaria.com",
  "input_type": "domain",
  "request_id": "req_example",
  "result": {
    "allowlisted": false,
    "blocked": false,
    "business_email": false,
    "cached": false,
    "disposable": false,
    "domain_exists": false,
    "free_provider": false,
    "has_mx": false,
    "level": "low",
    "mx_ip_address": [],
    "mx_ip_match": false,
    "mx_records": [],
    "recommendation": "allow",
    "review_required": false,
    "safe": true,
    "shared_mx": false,
    "temporary": false,
    "verdict": "safe"
  }
}
Pro tip
Use RiskMail API to monitor domain classification.

One GET request returns a clean disposable / safe verdict you can drop into any signup or login flow.

Mail server report · actividadesdeinfantilyprimaria.com

No mail server report: actividadesdeinfantilyprimaria.com

actividadesdeinfantilyprimaria.com resolves in DNS but does not have any MX records configured. That means it physically cannot receive email — any verification message you send will bounce. We recommend review for this domain so your signup flow can ask the user for a different address.

Missing MX is a common signal of typo'd corporate domains, parked domains, or domains that exist only for a website. It's not necessarily malicious, but accepting an address on this domain will produce a bounce and a frustrated user. The cheapest fix is to surface a clear "this domain can't receive email" error during signup.

Signals & methodology

The check is a live DNS query against the authoritative nameservers for the domain at the moment of the lookup, not a cached snapshot, so an MX record added today is reflected on the next verification. We distinguish three sub-cases that all surface as "no MX" to the API consumer but mean different things in operations: NXDOMAIN (the domain itself is unregistered), an A-record-only host (typically a parked or website-only domain), and a domain with SPF/DMARC published but no MX (a common configuration mistake). The MX records panel on this page shows which sub-case applies.

How to handle this in your product

The most common cause of a no-MX response on a real product is a typo: the user meant gmail.com and entered something close. Returning a friendly inline error during the signup form — rather than after the welcome email bounces — saves the user a confused day and removes a hard bounce from your sender reputation. If you accept domain typos as part of normal traffic, a "did you mean…" suggestion based on the closest known-good domain is a low-effort follow-up.

This report is generated by the RiskMail Email Risk API and reflects the most recent signal pipeline run for actividadesdeinfantilyprimaria.com.

Catch un-deliverable domains like actividadesdeinfantilyprimaria.com before they hit your bounce rate.
Try the API Read docs

Frequently asked questions

Is actividadesdeinfantilyprimaria.com a disposable email domain?
Not directly — actividadesdeinfantilyprimaria.com currently has no MX records, so mail cannot be delivered to it. RiskMail flags this as a no-MX domain rather than a disposable one.
Does actividadesdeinfantilyprimaria.com have MX records?
No — RiskMail did not find MX records for actividadesdeinfantilyprimaria.com. Mail to this domain cannot be delivered until MX records are configured.
Should I block signups from actividadesdeinfantilyprimaria.com?
RiskMail does not currently recommend blocking actividadesdeinfantilyprimaria.com. Combine this verdict with your own product signals before deciding.
How does RiskMail classify actividadesdeinfantilyprimaria.com?
actividadesdeinfantilyprimaria.com currently publishes no MX records, so RiskMail cannot derive a delivery-capable verdict.
Can I re-check actividadesdeinfantilyprimaria.com?
Yes — use the Re-check button on this page. Each public domain re-check is rate-limited to once every 24 hours by default to protect upstream DNS servers.
Domain lookup index

Explore more domain checks

Browse other domains in the RiskMail directory. Click any domain for its full classification and MX report.

Browse all domains →