No mail server report: actividadesdeinfantilyprimaria.com
actividadesdeinfantilyprimaria.com resolves in DNS but does not have any MX records configured. That means it physically cannot receive email — any verification message you send will bounce. We recommend review for this domain so your signup flow can ask the user for a different address.
Missing MX is a common signal of typo'd corporate domains, parked domains, or domains that exist only for a website. It's not necessarily malicious, but accepting an address on this domain will produce a bounce and a frustrated user. The cheapest fix is to surface a clear "this domain can't receive email" error during signup.
Signals & methodology
The check is a live DNS query against the authoritative nameservers for the domain at the moment of the lookup, not a cached snapshot, so an MX record added today is reflected on the next verification. We distinguish three sub-cases that all surface as "no MX" to the API consumer but mean different things in operations: NXDOMAIN (the domain itself is unregistered), an A-record-only host (typically a parked or website-only domain), and a domain with SPF/DMARC published but no MX (a common configuration mistake). The MX records panel on this page shows which sub-case applies.
How to handle this in your product
The most common cause of a no-MX response on a real product is a typo: the user meant gmail.com and entered something close. Returning a friendly inline error during the signup form — rather than after the welcome email bounces — saves the user a confused day and removes a hard bounce from your sender reputation. If you accept domain typos as part of normal traffic, a "did you mean…" suggestion based on the closest known-good domain is a low-effort follow-up.
This report is generated by the RiskMail Email Risk API and reflects the most recent signal pipeline run for actividadesdeinfantilyprimaria.com.